PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG467300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 120aa    MW: 12508.5 Da    PI: 11.0954
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG467300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB67.42.7e-2162118763
                NF-YB   7 flPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktin 63 
                           lP+an++r+m++v+P+  k+s  ak+++++c +ef++fv++eas+k+q+++r+ i+
  Pavir.1NG467300.1.p  62 GLPMANLVRLMRQVIPKGVKVSARAKHLTHDCTVEFVGFVAGEASEKAQAQHRRIIS 118
                          69****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.2E-1460119IPR009072Histone-fold
PfamPF008081.4E-1262119IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471133.39E-1263119IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MDKALSSAVT TKLRKIERMG RKAKRGGAKK GVRDTEKTKV APADDCASPG GEGGSTASAA  60
AGLPMANLVR LMRQVIPKGV KVSARAKHLT HDCTVEFVGF VAGEASEKAQ AQHRRIISP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432571e-101AC243257.1 Panicum virgatum clone PV_ABa103-H05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701062.11e-39PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotQ6Z3483e-23NFYB1_ORYSJ; Nuclear transcription factor Y subunit B-1
TrEMBLK3YVP37e-36K3YVP3_SETIT; Uncharacterized protein
STRINGSi018339m2e-35(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136592631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.16e-14nuclear factor Y, subunit B4